PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S23161.10
Common NameJCGZ_18501, LOC105641516
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YB
Protein Properties Length: 167aa    MW: 17002.9 Da    PI: 8.2101
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S23161.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB153.53.9e-481811797
          NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                   mkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+kyre+egek
  Jcr4S23161.10  1 MKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKIYLQKYREMEGEK 81
                   9******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471139.47E-34193IPR009072Histone-fold
PfamPF008085.1E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.104.2E-45193IPR009072Histone-fold
PRINTSPR006155.5E-221937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.5E-223856No hitNo description
PRINTSPR006155.5E-225775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MKKALPANAK ISKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF  60
EEYVEPLKIY LQKYREMEGE KSSMGRQGEK DGAGGSGGGG AAAGGGGSGG GVSSSAGGGA  120
GGGGFNGGGQ GMYGGMMMMG HHQGHMYGSG GYHQQMGIGK GGSGNSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A5e-391761893NF-YB
4awl_B5e-391761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-391761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR2322761e-159KR232276.1 Vernicia fordii nuclear transcription factor Y subunit B-11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012081482.11e-115PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233109e-59NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A067K1C41e-115A0A067K1C4_JATCU; Uncharacterized protein
STRINGVIT_19s0015g00440.t014e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-57nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]